General Information

  • ID:  hor004671
  • Uniprot ID:  Q3E880
  • Protein name:  Root meristem growth factor 1
  • Gene name:  GLV11
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  RGF family
  • Source:  Plant
  • Expression:  Not regulated by auxin . |In roots, expressed only in the quiescent center (QC) and the columella stem cells (CC) initials . |Expressed in root tips, only in the quiescent center and the columella stem cells.
  • Disease:  NA
  • Comments:  Not regulated by auxin.
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005515 protein binding; GO:0008083 growth factor activity
  • GO BP:  GO:0007165 signal transduction; GO:0008284 positive regulation of cell population proliferation; GO:0009786 regulation of asymmetric cell division; GO:0010078 maintenance of root meristem identity; GO:0010082 regulation of root meristem growth; GO:0010608 post-transcriptional regulation of gene expression; GO:0010628 positive regulation of gene expression; GO:0016036 cellular response to phosphate starvation; GO:0030154 cell differentiation; GO:0051302 regulation of cell division; GO:2000023 regulation of lateral root development; GO:2000067 regulation of root morphogenesis; GO:2000280 regulation of root development; GO:2000377 regulation of reactive oxygen species metabolic process
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  DYSNPGHHPPRHN
  • Length:  13(104-116)
  • Propeptide:  MVSIRVICYLLVFSVLQVHAKVSNANFNSQAPQMKNSEGLGASNGTQIAKKHAEDVIENRKTLKHVNVKVEANEKNGLEIESKEMVKKRKNKKRLTKTESLTADYSNPGHHPPRHN
  • Signal peptide:  MVSIRVICYLLVFSVLQVHA
  • Modification:  T2 Sulfotyrosine;T10 Hydroxyproline
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [GLV11p]: Acts as a peptide hormone recognized by receptors (e.g. RGI1 and RGI2) to trigger signaling events including the regulation of RITF1 expression and leading to the production of reactive oxygen species (ROS) in roots to modulate meristem size (Pu
  • Mechanism:  Maintains the postembryonic root stem cell niche by regulating the expression levels and patterns of the transcription factor PLETHORA (PLT), mainly at the post-transcriptional level.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q3E880-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004671_AF2.pdbhor004671_ESM.pdb

Physical Information

Mass: 174179 Formula: C65H90N24O20
Absent amino acids: ACEFIKLMQTVW Common amino acids: HP
pI: 7.8 Basic residues: 4
Polar residues: 5 Hydrophobic residues: 0
Hydrophobicity: -245.38 Boman Index: -5350
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 0
Instability Index: 4684.62 Extinction Coefficient cystines: 1490
Absorbance 280nm: 124.17

Literature

  • PubMed ID:  20798316
  • Title:  Secreted Peptide Signals Required for Maintenance of Root Stem Cell Niche in Arabidopsis